Vial Icon Peptide Vial

Cagrilintide (5mg)

Original price was: $90.00.Current price is: $72.00.

In stock

Quantity Per Item Price Per Item Price
1-2 $72.00
3-5 $68.40
6-10 $64.80
11-20 $61.20
21+ $54.00

DISCLAIMER: All products listed on this site are for research purposes ONLY. This product is NOT intended for human or animal consumption of any kind and are subject to our terms of usage.

This product is in powder form and is not reconstituted.

Only qualified professionals with appropriate expertise should manage and handle this product. The distributor, manufacturer, and seller of this product disclaim any responsibility for its misuse or any resulting consequences. By accessing this product, you consent to comply with these terms and conditions.

Bottle: vial – sealed – flip top
Vial size: 3ml
Form: powder (lyophilized)
Not reconstituted

Test Results

Cagrilinitide 5mg

Date Tested:
October 4, 2025
Purity:
99.887%
Weight:
6.33mg
Endotoxins(LPS):
Pass ionicons-v5-e

Cagrilintide Properties

  • Source: PubChem
  • Form: Lyophilized powder
  • Unit size: 5mg/vial
  • Unit quantity: 1 vial
  • Molecular formula: C194H312N54O59S2
  • Molecular weight: 4409 g/mol
  • Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
  • CAS number: 1415456-99-3

High Quality Research Peptides

Liberty Peptides is committed to providing high-quality research chemicals to the American market. With us you can rely on:

At Liberty Peptides, quality and integrity are very important. Thatโ€™s why weโ€™ve chosen to partner with Freedom Diagnostics for all our third-party Certificate of Analysis testing. Their reputation for precision, transparency, and cutting-edge technology makes them the gold standard in peptide validation.

Beyond exceptional testing, Freedom Diagnostics shares our commitment to our great country. A portion of every test supports veteran-focused charities, including the Wounded Warrior Project and the Gary Sinise Foundationโ€”aligning perfectly with our values.


โ€œDonโ€™t settle for less when you can have the best. Whether youโ€™re a researcher, a lab manager, or an institution driving innovation, Freedom Diagnostics is your trusted partner for peptide testing that delivers results you can rely onโ€”and a mission you can believe in.โ€

Other Peptides