Your cart is currently empty!
My Cart
Sale!
Cagrilintide (5mg)
Original price was: $99.00.$80.00Current price is: $80.00.
This product is provided in lyophilized powder form and requires reconstitution. Lyophilization is a process that removes water from the peptide, enhancing its stability during storage.
In stock
| Quantity | Per Item Price | |
|---|---|---|
| 1-2 | $80.00 | |
| 3-5 | $76.00 | |
| 6-10 | $72.00 | |
| 11-20 | $68.00 | |
| 21+ | $60.00 |
DISCLAIMER
All products listed on this site and for research purposes ONLY. This product is NOT intended for human or animal consumption of any kind.
Only qualified professionals with appropriate expertise should manage and handle this product. The distributor, manufacturer, and seller of this product disclaim any responsibility for its misuse or any resulting consequences. By accessing this product, you consent to comply with these terms and conditions.
Certificate of Analysis
HPLC
Mass Spectrometry
Cagrilintide Properties
Source: PubChem
Unit size: 5mg/vial
Bottle: Vial- Flip top – Sealed
Vial size: 3ml
Unit quantity: 1 vial
Molecular formula: C194H312N54O59S2
Molecular weight: 4409g/mol
CAS Number: 1415456-99-3
Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2