Your cart is currently empty!
This product is provided in lyophilized powder form and requires reconstitution. Lyophilization is a process that removes water from the peptide, enhancing its stability during storage.
DISCLAIMER
All products listed on this site and for research purposes ONLY. This product is NOT intended for human or animal consumption of any kind.
Only qualified professionals with appropriate expertise should manage and handle this product. The distributor, manufacturer, and seller of this product disclaim any responsibility for its misuse or any resulting consequences. By accessing this product, you consent to comply with these terms and conditions.
Source: PubChem
Unit size: 5mg/vial
Unit quantity: 1 vial
Molecular formula: C194H312N54O59S2
Molecular weight: 4409g/mol
CAS Number: 1415456-99-3
Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2
Source: PubChem
Unit size: 5mg/vial
Unit quantity: 1 vial
Molecular formula: C187H291N45O59
Molecular weight: 4114 g/mol
CAS Number: 910463-68-2
New Members Save 10% On Their First Order With Liberty Peptides!