Engineered for rigorous scientific inquiry, this peptide is provided in a lyophilized format to preserve structural integrity during transit and storage. Our products are intended for investigational use only and is not suitable for human or animal consumption. Detailed Certificates of Analysis (CoA) are available to support experimental reproducibility and confirm molecular weight and purity.
In Stock
FOX04-DRI (10mg)
10mg โข Single Vial
$200.00
In stock
| Quantity | Per Item Price | |
|---|---|---|
| 1-2 | 0% | $200.00 |
| 3-5 | 5% | $190.00 |
| 6-10 | 10% | $180.00 |
| 11-20 | 15% | $170.00 |
| 21+ | 25% | $150.00 |
Order this product by 12:00 PM EST and it will be shipped to you today!
Research Use Only
DISCLAIMER: All products listed on this site are for research purposes ONLY. This product is NOT intended for human or animal consumption of any kind and are subject to our terms of usage.
Only qualified professionals with appropriate expertise should manage and handle this product. The distributor, manufacturer, and seller of this product disclaim any responsibility for its misuse or any resulting consequences. By accessing this product, you consent to comply with these terms and conditions.
What is this product?
Product Specifications
Bottle
vial – sealed – flip top
Vial size
3ml
Form
powder (lyophilized)
Not reconstituted
Test Results
Sample: FOX04-DRI 10mg
Date Tested:
January 27, 2026
Purity:
99.27%
Weight:
10.68mg
Endotoxins(LPS):
<0.5 EU/mL
๐
Certificate of Analysis
Certificates of Analysis
Third-party tested for ~99% purity
FOX04-DRI Properties
- Source: PubChem
- Form: Lyophilized powder
- Unit size: 10mg/vial
- Unit quantity: 1 vial
- Molecular formula: C228H388N86O64
- Molecular weight: 5358.05 g/mol
- Sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG
- CAS number: 2460055-10-9
Frequently Asked Questions
Does the product come with instructions?
We do not provide instructions for use, as experimental design, preparation methods, and application parameters are determined independently by the researcher.
What is the amount of peptide in this product?
The amount listed represents a nominal value. Certificates of Analysis (CoAs) are generated from
representative samples within each production batch and reflect analytical results for the tested product. As with any batch-produced material, individual vials may exhibit minor quantitative variation. Detailed batch and analytical information can be found on the corresponding CoA.
Are additional supplies needed?
All peptides are supplied as lyophilized solids. Reconstitution is not performed prior to shipment, and any ancillary materials required for laboratory use are the responsibility of the researcher.
Related Products
Showing 3
of 36 products
How It Works
1
Precision Synthesis
Synthesized in dedicated, state of-the-art facilities. Advanced purification ensures superior analytical purity
2
Verified Purity
Every batch of raw materials is tested using UPLC and LC-MS to confirm chemical integrity
3
Same-Day Fulfillment
Products are dispatched same-day if ordered before 12:00 PM EST from our U.S. facility.
