Fast Shipping
Affordable Pricing
Professional Support
Highly Purified
In Stock

Tesamorelin, Ipamorelin (8/2 Blend)

$68.00

In stock

Quantity Per Item Price
1-2 $68.00
3-5 $64.60
6-10 $61.20
11-20 $57.80
21+ $51.00
Order this product by 12:00 PM EST and it will be shipped to you today!

Research Use Only

DISCLAIMER: All products listed on this site are for research purposes ONLY. This product is NOT intended for human or animal consumption of any kind and are subject to our terms of usage.

Only qualified professionals with appropriate expertise should manage and handle this product. The distributor, manufacturer, and seller of this product disclaim any responsibility for its misuse or any resulting consequences. By accessing this product, you consent to comply with these terms and conditions.

What is this product?

Engineered for rigorous scientific inquiry, this peptide is provided in a lyophilized format to preserve structural integrity during transit and storage. Our products are intended for investigational use only and is not suitable for human or animal consumption. Detailed Certificates of Analysis (CoA) are available to support experimental reproducibility and confirm molecular weight and purity.

Product Specifications

Bottle
vial – sealed – flip top
Vial size
3ml
Form
powder (lyophilized)
Not reconstituted

Test Results

Sample: Tesa, Ipamorelin 8/2mg

Date Tested:
January 27, 2026
Endotoxins(LPS):
< 0.05 EU/mL

Certificate of Analysis

Certificate of Analysis (Endotoxin)

Third-party tested for ~99% purity

Tesa Properties

  • Source: PubChem
  • Form: Lyophilized powder
  • Unit size: 8mg/vial
  • Unit quantity: 1 vial
  • Molecular formula: C223H370N72O69S
  • Molecular weight: 5196ย g/mol
  • Synonym: Tesamorelin acetate
  • Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
  • CAS number: 901758-09-6

Ipamorelin Properties

  • Source: PubChem
  • Form: Lyophilized powder
  • Unit size: 2mg/vial
  • Unit quantity: 1 vial
  • Molecular formula: C38H49N9O5
  • Molecular weight: 711.9 g/mol
  • Sequence: Aib-His-D-2-Nal-D-Phe-Lys
  • CAS number: 170851-70-4

Frequently Asked Questions

Does the product come with instructions?
We do not provide instructions for use, as experimental design, preparation methods, and application parameters are determined independently by the researcher.
What is the amount of peptide in this product?
The amount listed represents a nominal value. Certificates of Analysis (CoAs) are generated from representative samples within each production batch and reflect analytical results for the tested product. As with any batch-produced material, individual vials may exhibit minor quantitative variation. Detailed batch and analytical information can be found on the corresponding CoA.
Are additional supplies needed?
All peptides are supplied as lyophilized solids. Reconstitution is not performed prior to shipment, and any ancillary materials required for laboratory use are the responsibility of the researcher.

Related Products

How It Works

1

Precision Synthesis

Synthesized in dedicated, state of-the-art facilities. Advanced purification ensures superior analytical purity

2

Verified Purity

Every batch of raw materials is tested using UPLC and LC-MS to confirm chemical integrity
3

Same-Day Fulfillment

Products are dispatched same-day if ordered before 12:00 PM EST from our U.S. facility.
Join Waitlist We will inform you when the product arrives in stock. Please leave your valid email address below.