Engineered for rigorous scientific inquiry, this peptide is provided in a lyophilized format to preserve structural integrity during transit and storage. Our products are intended for investigational use only and is not suitable for human or animal consumption. Detailed Certificates of Analysis (CoA) are available to support experimental reproducibility and confirm molecular weight and purity.
Tesamorelin, Ipamorelin, BPC-157 (8mg/2mg/2mg Blend)
In stock
Research Use Only
DISCLAIMER: All products listed on this site are for research purposes ONLY. This product is NOT intended for human or animal consumption of any kind and are subject to our terms of usage.
Only qualified professionals with appropriate expertise should manage and handle this product. The distributor, manufacturer, and seller of this product disclaim any responsibility for its misuse or any resulting consequences. By accessing this product, you consent to comply with these terms and conditions.
What is this product?
Product Specifications
Test Results
Sample: Tesa, Ipamorelin, BPC-157 8/2/2mg
Certificate of Analysis
Certificate of Analysis (Endotoxin)
Third-party tested for ~99% purity
Tesa Properties
- Source: PubChem
- Form: Lyophilized powder
- Unit size: 8mg/vial
- Unit quantity: 1 vial
- Molecular formula: C223H370N72O69S
- Molecular weight: 5196ย g/mol
- Synonym: Tesamorelin acetate
- Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
- CAS number: 901758-09-6
Ipamorelin Properties
- Source: PubChem
- Form: Lyophilized powder
- Unit size: 2mg/vial
- Unit quantity: 1 vial
- Molecular formula: C38H49N9O5
- Molecular weight: 711.9 g/mol
- Sequence: Aib-His-D-2-Nal-D-Phe-Lys
- CAS number: 170851-70-4
BPC-157 Properties
- Source: PubChem
- Form: Lyophilized powder
- Unit size: 2mg/vial
- Unit quantity: 1 vial
- Molecular formula: C62H98N16O22
- Molecular weight: 1419.5 g/mol
- Synonym: Bepecin
- Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val
- CAS number: 137525-51-0
Frequently Asked Questions
Related Products
How It Works
Precision Synthesis
Synthesized in dedicated, state of-the-art facilities. Advanced purification ensures superior analytical purity
Verified Purity
Fast Fulfillment to Your Facility
Orders are safely dispatched directly to your research facility
